-
- 12’ X 6’ Portable Soccer Goal
- ●High quality collapsible soccer goal can withstand indoor and outdoor environments●Heavy duty polyester netting●Firm powder coated steel tubes with push-pin locking system for quick assembly ●6 ground stakes help secure goal to ground●Pack includes carry
W.E. Sporting Goods Limited [Verified]
-
- Fish meal
- Model Number: 001-#5136 Brand Name: deda Key Specifications/Special Features: Specifications:Fish meal for saleManufacturer priceBest priceProtein: 65% fish meal for saleFeatures:Fish contains a variety of nutrients comprise animal tissue, maint...
Shenzhen Sunsky Technology Limited [Verified]
-
- Mini fish tank, acrylic material
- Model Number: yg1-#2113 Brand Name: Fuguanda Key Specifications/Special Features: Productdetails:AcrylicrawmaterialAllshapesareaccepted,round,square,oval,rectangular,uniqueSmalltrialorderisacceptedSpecializinginOEM,ODMordersHarmless,environment-...
Fuguanda Acrylic Crafts Factory [Verified]
-
- Fish Feed 36%
- Model Number: Fish feed 36% protein Brand Name: YATAI Key Specifications/Special Features: Fish Feed 36%Specifications:Protein: 36% minMoisture: 10% maxAsh: 10% maxFat: 7-8%Fiber: 4% maxLysine: 1.2% minPhosphorous: 0.8% minMethionine: 0.4% minSi...
-
- Machine-made 1/4 gallon glass fish bowl
- Model Number: JDY-802 Brand Name: JINGDU Key Specifications/Special Features: Machine-made 1/4 gallon glass fish bowlClassicdesign and beautiful appearanceVarious shapes are availableSize: Top diameter: 9cm Max dia.: 14cmHeight: 14cmCapacity: 1/...
Jinjiang Jiaxing Groups Co. Ltd [Verified]
-
- Red and white stripes aquarium stone ornament
- Model Number: ZXA-46-#2369 Brand Name: zongxiao Key Specifications/Special Features: Our company supplies various kinds of stone for aquarium and gardenAquarium rock1. Shape: natural shape.2. Material: natural stone3. Color: Red and white stri...
SHIJIAZHUANG ZONGXIAO TRADING CO.,LTD [Verified]
-
- LED Aquarium Light
- Model Number: 409 AK Seriers Key Specifications/Special Features: Lighting system is designed to provide all ranges of color spectrum required by corals andPlants to enhance their growth rate, improves their coloration and at the same time givin...
Fuzhou Canwell Import & Export Co Ltd [Verified]
-
- New super white fish tank no need to replace water factory direct supply
- Model Number: honglang#001 Brand Name: HONGLANG Key Specifications/Special Features: Mode: HL-MFColor: WhiteVoltage: 24VProduct size: 26x19x24cmPackage size: 31x23x28cmMaterial: Acrylic, AbsAccessories: Ceramic ring, activated charcoal,filtrat...
Jinjiang Jiaxing Home Co.,Ltd. [Verified]
-
- Fashionable tops aquarium pumps and airline tubes online shopping
- Model Number: DY-ST01-002 Key Specifications/Special Features: Details:Material: 100% silicone materialSilicone grade: industrial grade, food grade, medical gradeDiameter: 1-100mmTemperature range: -50°C-230°CHardness: 30-80 shore AColor: tran...
-
- Fish Tank Water Changer, Environment Friendly
- Model Number: GX-WC Brand Name: GX Key Specifications/Special Features: Suitable for aquarium fish tank water and sand filterCan be ruled out in trash fish food residue and gravelBeloved fish does no harmSimple operationEasy to damageCustomers c...
Shinning Industries Ltd [Verified]
-
- Hot new products customize plastic fish tank, aquarium with LED light
- Model Number: WB-007 aquarium fish tank-014 Brand Name: Yake Key Specifications/Special Features: Aquarium and accessory type: aquariumsFeatures: eco-friendly, stockedPlace of origin: Guangdong, China (Mainland)Brand name: YKModel number: WB-0...
YAKE INDUSTRIAL CO.,LIMITED [Verified]
-
- Lightweight aquarium stone of river washing
- Model Number: ZXA-01-2-1 Brand Name: zongxiao Key Specifications/Special Features: Aquarium rock (ZXA01)Shape: natural river washing shapeMaterial: natural stoneColors: yellow, brown, light greenSizes: 1-10, 10-25, 10-30, 30-50 and 50-100cmPacki...
SHIJIAZHUANG ZONGXIAO TRADING CO.,LTD [Verified]
-
- Aqurium rock, washed for aquarium decoration, porous, lightweight, natural shape
- Model Number: ZXA01 Brand Name: zongxiao Key Specifications/Special Features: Our company supply various kinf of rock for aqarium and gardenAquarium rockShape: naturalMaterial: natural stoneColours: yellow, brown, light greenSize: 1-10, 10-25, 1...
SHIJIAZHUANG ZONGXIAO TRADING CO.,LTD [Verified]
-
- Large capacity plastic fish bowl, beautiful appearance, plastic design
- Model Number: WY029 Key Specifications/Special Features: Size: 4.2LMaterial: PETWeight:172gOEM/ODM: yesPacking: OPP bagWelcome you to check and inquireWe will try best to offer you the best service and high-quality goods. Shipping I...
Yiwu Weiyue Commodity Co.,Ltd [Verified]
-
- Pump Station
- Model Number: ZLB/Q-1 Brand Name: Fuchun Key Specifications/Special Features: Type ZLB/Q pumps are single-stage vertical axial flow pumps. Type HLB/Q mixed flow pump was high efficiency, good anti-cavitation’s performance. They are provided for ...
Fuchun Industry Development Co. Ltd Shenzhen China [Verified]
-
- WiFi Control 48-inch Cree Chips 72*3W 216w Full Spectrum LED Aquarium Light with Iron Housing
- Model Number: HLX-A06-C120-72X3W-B Brand Name: HLX Key Specifications/Special Features: Product advantages:1. AdvancedWiFi controlusing smartphone2. Full spectrum: white 18000K, warm white 2700K, red 630nm, green 525nm, blue 470nm, UV 430nm, cus...
Jinjiang Jiaxing Shoes & Garments Co. Ltd [Verified]
-
- WiFi control 24-inch Cree chips 36*3W 108w full spectrum LED aquarium light with iron housing
- Model Number: HLX-A06-C60-36X3W-B Brand Name: HLX Key Specifications/Special Features: Product advantages:1. AdvancedWIFI controlled by Smartphone2. Full spectrum: white 18000K, warm white 2700K, red 630nm, green 525nm, blue 470nm, UV 430nm, cus...
Jinjiang Jiaxing Shoes & Garments Co. Ltd [Verified]
-
- High Quality Floating Fish Feed Pellet for Catfish
- Model Number: animal feed Brand Name: yatai Key Specifications/Special Features: Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitat...
-
- Fish Feed 42%
- Model Number: Fish feed 42% Brand Name: YATAI Key Specifications/Special Features: Fish feed 42%Specifications:Protein: 42% minMoisture: 10% maxAsh: 10% maxFat: 7-8%Fiber: 4% maxLysine: 1.2% minPhosphorous: 0.8% minMethionine: 0.4% minSize: 1- 8...
-
- 100% new material factory low price eye-catching curved square shape glass fish bowl for sale
- Model Number: SSYG-017-1 Brand Name: sunsee Key Specifications/Special Features: Specifications:1. Wholesale2. Top grade acrylic3. Environment-friendly4. Very fashionable and beautiful5. Excellent weather fastPacking:EPE, polybag, paper carton, ...
Ningbo Sunsee Acrylic Industry Co. Ltd [Verified]
Top Search This Week
- 2timesbeauty
New Products
-
Table 808nm Diode Laser Machine for Hair Removal
price: Negotiable
-
Automatic Blanket Wash Up Dry Cloth for KOMORI
price: Negotiable
-
Square Silver Venetian Wall Mirror
price: Negotiable